PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.22252s0094.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family S1Fa-like
Protein Properties Length: 74aa    MW: 8100.83 Da    PI: 10.7779
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.22252s0094.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA142.48.8e-45573270
                  S1FA  2 avakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                          + +k+e+kGlnPGlivllv+ggll++flvgn+ily+yaqknlPPrkkkP+skkk+k+ek+kqGv+vPGe
  Bostr.22252s0094.1.p  5 FSGKIESKGLNPGLIVLLVIGGLLVTFLVGNFILYTYAQKNLPPRKKKPLSKKKMKKEKMKQGVQVPGE 73
                          5689****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046892.7E-39973IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 74 aa     Download sequence    Send to blast
MAEEFSGKIE SKGLNPGLIV LLVIGGLLVT FLVGNFILYT YAQKNLPPRK KKPLSKKKMK  60
KEKMKQGVQV PGE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3806293e-92AF380629.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds.
GenBankAK1189703e-92AK118970.1 Arabidopsis thaliana At3g09735 mRNA for unknown protein, complete cds, clone: RAFL21-30-H15.
GenBankAY0541293e-92AY054129.1 Arabidopsis thaliana AT3g09731 mRNA, complete cds.
GenBankAY0871863e-92AY087186.1 Arabidopsis thaliana clone 32612 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006298914.12e-28hypothetical protein CARUB_v10015035mg
SwissprotQ423372e-19S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLA0A087H8A93e-29A0A087H8A9_ARAAL; Uncharacterized protein
STRINGBra029784.1-P1e-27(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769